<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
07LPH149 07LPH149 Cameroon 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 39

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106A F227L P14X, V35T, E36D, E40Q, K43E, K49R, V60I, D123E, S162C, D177E, I178L, T200A, Q207E, F214L, V245T, A272P, T286A, I293V, K311R, Y339W, R356K, A376S, K390R, T403M, E432D, V466I, S468P, L469F, H483N, L491P, S519T  
>07LPH149| codons 1-527
PISPIETVPVKLKXGMDGPKVKQWPLTEEKIKALTDICTQMEEEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTWQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKIVPFTDTTNQKTELQ
AINLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVTQIIEQLIK

References
Author Title Citation
Burda, ST HIV-1 reverse transcriptase drug-resistance mutations in chronically infected individuals receiving or naive to HAART in Cameroon. J Med Virol, 2010