<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LPH02NJM LPH02NJM Cameroon 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103S, G190A   V35T, S48E, V60I, I135V, S162A, K173I, Q174K, D177E, I178M, T200A, Q207E, V245T, W252G, A272P, V276I, L282X, L283X, T286A, V292I, I293V, G335S, Y339W, R356K, K390R, T403M, V435A  
>LPH02NJM| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSGTVNDIQKLVGKLNWASQIYPGIKIKQLCKXXRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQSQWTWQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETF

References
Author Title Citation
Burda, ST HIV-1 reverse transcriptase drug-resistance mutations in chronically infected individuals receiving or naive to HAART in Cameroon. J Med Virol, 2010