<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
06LPH20SC 06LPH20SC Cameroon 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 87

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V F116Y Y181C V108I, F227L K20R, V35T, E36D, T39L, K49R, S68G, K122E, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, F214L, H221Y, E224D, P243H, V245Q, K281R, L283I, T286A, E291D, V292I, I293V, D320X, S322T, I326V, G335D, R356K, M357K, G359S, A371V, I375V, K390R, A400T, T403M  
>06LPH20SC| codons 1-424
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICLEMEKEGKISRIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYYSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFRTKNPEMVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKDPPLLWMGYELHPDKWT
VQHIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLIRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYEPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVK

References
Author Title Citation
Burda, ST HIV-1 reverse transcriptase drug-resistance mutations in chronically infected individuals receiving or naive to HAART in Cameroon. J Med Virol, 2010