<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
X2721_1 X2721_1 Spain 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, P39S, R41K, D60E, Q61E, L63P, H69K, L89M, I93L  
>X2721_1| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, K122E, D123S, K173I, Q174K, D177E, I178M, Q207A, R211S, V245E  
>X2721_1| codons 1-256
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVND

References
Author Title Citation
Cuevas, M Incidence of non-B subtypes of HIV-1 in Galicia, Spain: High frequency and diversity of HIV-1 among men who have sex with men. Euro Surveill, 2009