<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
X2687_1 X2687_1 Spain 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, P39T, R41K, R57K, D60E, Q61N, H69Y, I72T, L89M  
>X2687_1| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVKQYE
NILIEICGYKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, E40D, K49R, V106I, D123E, I135L, S162C, E169D, K173A, Q174K, D177G, I178L, T200A, Q207D, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294T, E297A, I329V  
>X2687_1| codons 1-336
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPGLVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQ

References
Author Title Citation
Cuevas, M Incidence of non-B subtypes of HIV-1 in Galicia, Spain: High frequency and diversity of HIV-1 among men who have sex with men. Euro Surveill, 2009