<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
X2629_1 X2629_1 Spain 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122R, D123E, S162C, R172K, D177E, I178M, I180L, E194K, A272P, K277R, I293V, G333D  
>X2629_1| codons 1-346
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DREFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPEMVL
YQYMDDLYVGSDLKIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQDQGQWTYQIYQEPF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18E, I62V, L63P, V77I, I93L  
>X2629_1| codons 1-99
PQITLWQRPLVTIKIGGELKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Cuevas, M Incidence of non-B subtypes of HIV-1 in Galicia, Spain: High frequency and diversity of HIV-1 among men who have sex with men. Euro Surveill, 2009