<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
X2572_1 X2572_1 Spain 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, E35D, M36I, R41K, R57K, Q61N, C67D, I72V  
>X2572_1| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEIDGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, T69S, I135T, I142V, F214L, V245K, K277R, T286A, I293V, E297K  
>X2572_1| codons 1-326
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLI

References
Author Title Citation
Cuevas, M Incidence of non-B subtypes of HIV-1 in Galicia, Spain: High frequency and diversity of HIV-1 among men who have sex with men. Euro Surveill, 2009