<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
X2496_1 X2496_1 Spain 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12V, E35D, R41RK, R57K, I62V, L63A  
>X2496_1| codons 1-99
PQITLWQRPLVVIKIGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVKQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, K104R, D121Y, K122E, I135T, E138EA, I142V, S162A, T200N, R211K, V245K, L283I, R284K, T286V, A288S, I293V, I329L  
>X2496_1| codons 1-331
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRNKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIKGVKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQK

References
Author Title Citation
Cuevas, M Incidence of non-B subtypes of HIV-1 in Galicia, Spain: High frequency and diversity of HIV-1 among men who have sex with men. Euro Surveill, 2009