<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GT54159108 GT54159108 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV V75I V106M, Y188YC   V35T, T39E, S48T, V60I, K122E, K173A, Q174K, D177E, I178M, T200A, Q207E, R211K, V245Q, A272P, K277KR, L283I, V292I, I293V  
>GT54159108| codons 1-322
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEMVI
YQYVDDLCVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, K20R, M36I, R41K, L63LFPS, H69K, V77I, L89M, I93L  
>GT54159108| codons 1-99
PQITLWQRPLVTIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009