<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2305695 2305695 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I   K103N   S3R, V35T, T39E, E40D, S48T, K122E, D123S, F171FL, K173IT, Q174K, I178IM, T200A, Q207D, R211K, V245Q, E248ED, A272P, K277KT, L279M, T286A, E291D, V292I, I293V, E297V, V317A, Q334D  
>2305695| codons 1-335
PIRPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEDMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPLRTKNPDMVI
YQYIDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVTQMCKLLRGAKALTDIVPLTVEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGDG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, G17GD, M36I, N37S, R57RK, L63P, H69K, L89M, I93L  
>2305695| codons 1-99
PQITLWQRPLVTIKVGDQLKEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009