<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TJC2389108 TJC2389108 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V   V106M V179D P4T, K20R, E28A, V35T, T39EK, S48T, V60I, K103R, K122E, D123S, I132V, A158S, K173T, Q174K, D177E, G196E, T200A, Q207E, F214L, V245Q, A272P, L283I, E291D, V292I, I293V, G333E, Q334H R172S
>TJC2389108| codons 1-335
PISTIETVPVKLKPGMDGPRVKQWPLTAEKIKALTEICKEMEKEGKITKIGPENPYNTPI
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSMTVLDVGDAYFSVPL
DESFRKYTAFTVPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFSTKNPEIDI
YQYVDDLYVGSDLEIEQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEHG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   T12TS, L19I, M36I, L63P, H69K, L89IM, I93L  
>TJC2389108| codons 1-99
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMMTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009