<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TJC2381560 TJC2381560 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V   K103KN, V106M, Y188L   P4S, V35T, E36A, T39E, S48T, K122KE, D123E, S162A, K173T, V179VI, T200A, Q207E, R211K, V245Q, A272P, K277R, L283I, E291D, V292I, I293V Q197AE
>TJC2381560| codons 1-333
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPDIII
YQYVDDLLVGSDLEIGEHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36I, R41K, Q61D, L63T, I64L, H69K, L89M, I93L  
>TJC2381560| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
DITLEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009