<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GT00190091 GT00190091 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, T215F   K103N, Y181I   V35T, T39E, S48T, K122E, I135T, K173T, Q174K, D177E, T200A, Q207N, R211K, D218E, V245Q, A272P, K277R, E291D, V292I, I293V  
>GT00190091| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
IQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFFTPEKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, K20R, E21X, E35D, M36I, R41K, H69K, L89M, I93L  
>GT00190091| codons 1-99
PQITLWQRPLVTIKVGGQIRDALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009