<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GT00298319 GT00298319 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215TFIS V75I K103N V108VI I31IL, V35T, T39EK, S48T, E53D, V60VI, V90VI, K122E, D123S, I132L, K173T, Q174R, I178L, T200A, Q207E, R211K, F214FL, H221HY, V245Q, A272P, T286A, E291D, V292I V254I
>GT00298319| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICKEMEKEGKITKIGPDNPYNTPI
FAIKKKDSTKWRKLIDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DESFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTRNPDLVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLSTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTINDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, R41K, D60E, L63LP, H69K, V82VI, L89M, I93L  
>GT00298319| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009