<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TJC2414141 TJC2414141 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V   K103N, V106M   L34I, V35T, T39K, S48T, K122E, D123S, T165L, K173A, D177E, T200A, Q207E, R211RK, F214FL, V245Q, D250E, A272S, K277R, K281R, T286A, E291D, V292I, I293V, V317A  
>TJC2414141| codons 34-335
ITEICKEMEKEGKITKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLG
IPHPAGLKKNKSMTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGW
KGSPAIFQSSMLKILEPFRAQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWG
LTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKESWTVNDIQKLVGKLNWASQIYSG
IKVRQLCRLLRGAKALTDIVPLTEEAELELAENREILKEPVHGAYYDPSKDLIAEIQKQG
QG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63P, H69K, I93L  
>TJC2414141| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009