<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GT00464533 GT00464533 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, V35T, E36A, T39E, S48T, V60I, K122E, D123S, E138A, A158S, K173A, Q174K, T200A, Q207D, R211K, V245Q, A272P, K277R, E291D, V292I, I293V  
>GT00464533| codons 1-321
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19X, M36I, N37S, R41K, L63LI, H69K, L89M, I93L  
>GT00464533| codons 16-99
GGQXKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQIIIEICGKKAIGTV
LVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009