<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GT00237954 GT00237954 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V V75I, K219Q V106M V179D V35R, T39D, S48T, V60I, K102KR, K103KR, K104KR, K122E, D123N, I132L, K173Q, Q174G, D177E, T200A, I202V, Q207E, R211K, F214L, V245Q, A272K, R284K, T286A, E291D, V292I, I293V, P294T, E308K, L310C, S322T, Q334E  
>GT00237954| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICDEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKRRRSMTVLDVGDAYFSVPL
DENFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQGNPEIDI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYKGIKVKQLCKLLKGAKALTDIVTLTEEAE
LELAENRKICKEPVHGVYYDPTKDLIAEIQKQGEG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19V, E35D, M36I, R41K, K45R, L63P, H69K, V77VI, L89M, I93L  
>GT00237954| codons 1-99
PQITLWQRPLVTIKVGGQVKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009