<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2363278 2363278 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   T27S, V35T, E36A, T39E, S48T, K122KE, K173T, D177E, T200A, E204K, Q207D, R211K, V245Q, D250DE, A272P, K277R, T286TA, E291D, V292I, I293V  
>2363278| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEKLRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  Q58E I15V, L19I, E35D, M36I, P39PS, R41K, D60E, Q61E, L63P, H69K, L89M, I93L  
>2363278| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLSGKWKPKMIGGIGGFIKVREYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009