<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TJC2455335 TJC2455335 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63LV, H69K, V82I, L89M, I93L  
>TJC2455335| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M V75A, F77L, F116Y G190E P225H K20R, V35T, T39E, S48T, S68G, T69TI, K73M, W88S, K101R, K122E, E138A, R172K, K173A, V179G, T200A, Q207E, F214L, V245Q, A272P, T286A, V292I, I293V P157A
>TJC2455335| codons 1-323
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKRKDGIKWRMLADLRELNKRTQDFSEVQLGIPHPAGLRKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPMGWKGSAAIFQSSMTKILEPFKAQNPDIGI
YQYMDDLYVESDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSK

References
Author Title Citation
Wallis, CL Varied HIV drug resistance patterns among patients on failing antiretroviral therapy in the South African national roll-out programme. JAIDS, 2009