<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF10 JF10-(-)1w U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 48
2 SQV 20
3 AZT 96
4 DDI 116
5 DDC 56
6 D4T 52
7 3TC 52
8 PFA 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74LI, M184I, L210W V75T, T215C, K219R   V108I V118I, K122E, I178M, G196E, E203K, R211E, F214X  
>JF10-(-)1w| codons 32-258
KALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKITDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYIDDLYVGSDLEIEQHRTKIKELRQHLWE
WGXCTPDRKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, L90M G73S L10R, N37D, I62V, L63P, A71V, V77I, I93L  
>JF10-(-)1w| codons 1-99
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005