<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF09 JF09-9w U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 104
2 SQV 12
3 AZT 255
4 DDI 48
5 DDC 92
6 D4T 48
7 3TC 44
8 ABC+APV 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, L90M V11VI L10I, T12E, I15V, L19I, R41K, L63P, A71T  
>JF09-9w| codons 1-99
PQITLWQRPIIEIKVGGQIKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184V, T215F D67G, K219Q     S68G, V118I, I135T, Q197K, F214L, D218E  
>JF09-9w| codons 24-260
WPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKGGDRWRKLVDFRELNKR
TQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIR
YQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGKHRTKIE
ELRQHLLRWGLFTPEQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005