<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF08 JF08-(-)6w U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 72
2 SQV 24
3 AZT 104
4 DDI 32
5 DDC 8
6 D4T 16
7 3TC 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M   L10I, I15V, E35D, N37E, K45R, L63P, A71V, I93L, C95F  
>JF08-(-)6w| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMELPGRWKPRMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219Q     K43KQ, K64R, T69N, V118I, I135M, G196N, T200I, I202V, E204Q, Q207E, R211K, F214L, V245T  
>JF08-(-)6w| codons 32-257
KALVEICTEMEQEGKISKIGPENPYNTPVFAIRKKGSNRWRKLVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSMNNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEINQHRIKVEQLREHLLK
WGLFTPDQKHQKEPPFLWMGYELHPDKWTVQPITLPEKDSWTVNDI

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005