<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF07 JF07-8w U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 76
2 SQV 24
3 AZT 240
4 DDI 16
5 DDC 188
6 D4T 36
7 3TC 64
8 ABC+APV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69AD, M184V, L210W, T215Y K219KN     T39A, K43E, E44A, V118I, K122KE, I135T, S162C, R211K  
>JF07-8w| codons 22-262
KQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPG
IRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTK
IEELRQHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
G

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, K14R, R41K, L63P, A71V, I93L  
>JF07-8w| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005