<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF07 JF07-0w U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 76
2 SQV 24
3 AZT 240
4 DDI 16
5 DDC 188
6 D4T 36
7 3TC 64

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       T39A, K43E, E44A, V118I, K122KE, I135T, S162C, R211K  
>JF07-0w| codons 25-258
PLTEEKIKALVEICAELEEAGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRY
QYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEE
LRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, K14R, R41K, L63P, A71V, I93L  
>JF07-0w| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005