<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  S147SR E11D, S24G, D25E, L28I, V31I, L45IV, I72IV, K156N, T206S, T218S, D279N  
>INT-62| codons 5-286
IDKAQEDHEKYHSNWRAMAGEFNIPPIVAKEIVASCDKCQVKGEAMHGQVDCSPGIWQLD
CTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTST
TVKAACWWAGIKQEFGIPYNPQRQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAVFIHN
FKRKGGIGGYSAGERIVDIIASDIQTKELQKQISKIQNFRVYYRDSRDPLWKGPAKLLWK
GEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDNCVASRQD

References
Author Title Citation
Garrido, C Integrase variability and susceptibility to HIV integrase inhibitors: Impact of subtypes, antiretroviral experience and duration of HIV infection. J Antimicrob Chemother, 2009