<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF03 JF03-8w U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 108
2 SQV 28
3 AZT 120
4 DDI 40
5 DDC 36
6 D4T 52
7 3TC 48
8 ABC+APV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, I15V, K20R, M36I, I62V, L63P, K70Q, L89M  
>JF03-8w| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHQAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219N     E44D, A98S, K122E, D123E, D177E, R211K  
>JF03-8w| codons 21-263
VKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFREL
NKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRT
KIEELRQHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL
VGK

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005