<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF02 JF02-8w U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 72
2 RTV 28
3 SQV 24
4 AZT 228
5 DDI 160
6 DDC 12
7 D4T 36
8 3TC 56
9 NVP 24
10 ABC+APV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82A, L90M L33I, G73S L10I, K14KR, L24LF, M36I, I62V, L63P, A71V, I93L  
>JF02-8w| codons 1-99
PQITLWQRPIVTIRIGGQLKEALFDTGADDTVIEEINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, V75AT, M184V, T215F T69G, K219Q K103N A98G K20R, V35I, K43E, S48T, K122E, I135M, V179I, G196E, L228H P52PHNT, P55PKQT, P59PT, D67.
>JF02-8w| codons 15-266
GMDGPRVKQWPLTEEKIKALIEICTELEEEGKITKIGPENPYNTPVFAIKKK.SGRWRKI
VDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPS
MNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLE
IEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWTVQPIVLPEKDSWTV
NDIQKLVGKLNW

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005