<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 INT-8 Spain 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    L28I, P30A, I72V, T112I, T122TI, T124N, D167E, V201I, T206S V260VL
>INT-8| codons 13-261
EKYHSNWRAMASDFNIPAVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKV
ILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKIIHTDNGSNFISNTVKAACWW
AGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAVFIHNFKRKGGIG
GYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQ
DNSDIKVLP

References
Author Title Citation
Garrido, C Integrase variability and susceptibility to HIV integrase inhibitors: Impact of subtypes, antiretroviral experience and duration of HIV infection. J Antimicrob Chemother, 2009