<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3 INT-3 Spain 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    L28I, S39C, T124A, K215N, S230N  
>INT-3| codons 25-275
DFNIPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYI
EAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYN
PQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDII
ATDIQTKELQNQITKIQNFRVYYRDNRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRK
AKIIRDYGKQM

References
Author Title Citation
Garrido, C Integrase variability and susceptibility to HIV integrase inhibitors: Impact of subtypes, antiretroviral experience and duration of HIV infection. J Antimicrob Chemother, 2009