<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1 INT-1 Spain 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L28I, P30A, S39C, I60V, V77A, L101I, T124TA, K173KR, I203M  
>INT-1| codons 7-273
KAQEEHEKYHNNWRAMASDFNIPAVVAKEIVACCDKCQLKGEAMHGQVDCSPGVWQLDCT
HLEGKIILVAAHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSATV
KAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLRTAVQMAVFIHNFK
RKGGIGGYSAGERIVDMIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGE
GAVVIQDNSDIKVVPRRKAKIIRDYGK

References
Author Title Citation
Garrido, C Integrase variability and susceptibility to HIV integrase inhibitors: Impact of subtypes, antiretroviral experience and duration of HIV infection. J Antimicrob Chemother, 2009