<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF02 JF02-0w U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 72
2 RTV 28
3 SQV 24
4 AZT 228
5 DDI 160
6 DDC 12
7 D4T 36
8 3TC 56
9 NVP 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L33I, G73S L10I, K14R, E35D, M36I, I62V, L63P, A71V, I93L  
>JF02-0w| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVIEDINLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74I, M184V, T215F T69G, K219Q K103N A98AG V35I, K43E, S48T, K66X, D67X, K122E, I135M, V179I, G196E, L228H  
>JF02-0w| codons 35-258
IEICTEMEEEGKITKIGPENPYNTPVFAIKKXXSGRWRKIVDFRELNKRTQDFWEVQLGI
PHPGGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGF
FTPDQKHQKEPPFHWMGYELHPDKWTVQPIVLPEKDSWTVNDIQ

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005