<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF01 JF01-8w U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 115
2 SQV 41
3 AZT 114
4 DDI 59
5 DDC 37
6 D4T 39
7 3TC 36
8 ABC+APV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, T215Y       E53D, L210F, V245E  
>JF01-8w| codons 22-261
KQWPLTEEKIKALVEICTELEKEGKISKIGPDNPYNTPVFAIKKKNSTRWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTK
IEELRQHLFRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQKLV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I54V, V82A Q58QE, L89V L10I, L63LP, A71V, C95X  
>JF01-8w| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKLIGGIGGFVKVREYD
QIPIEICGHKVIGTVLVGPTPANIIGRNVLTQIGXTLNF

References
Author Title Citation
Falloon, J Combination therapy with amprenavir, abacavir, and efavirenz in human immunodeficiency virus (HIV)-infected patients failing a protease-inhibitor regimen: pharmacokinetic drug interactions and antiviral activity. Clin Infect Dis, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005