<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
100025 100025 India 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14KR, L19I, M36I, R41K, L63S, H69K, L89M, I93L  
>100025| codons 1-99
PQITLWQRPLVSIRIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, K49R, V60I, D121Y, K122E, I135T, K173T, D177E, I178IM, T200A  
>100025| codons 42-206
EKEGKITRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLK
KKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQ
SSMTKILEPFRTQNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELR

References
Author Title Citation
Iqbal, HS Primary HIV-1 drug resistance and polymorphic patterns among injecting drug users (IDUs) in Chennai, southern India. J Int Assoc Physicians AIDS Care (Chic), 2009