<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
100021 100021 India 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5LI, T12S, I13V, L19I, R41K, L63P, I64M, H69K, L89M, I93L  
>100021| codons 1-99
PQITIWQRPLVSVKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPMEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, W88C, K101Q, D121Y, K122E, I135R, S162A, K173T, D177DG, T200A, I202V, Q207E, W212WG W71WG
>100021| codons 41-216
MEKEGKISKIGPENPYNTPIFAIKKKDSTKGRKLVDFRELNKRTQDFCEVQLGIPHPAGL
QKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIF
QASMTKILEPFRTQNPGIVIYQYMDDLYVGSDLEIGQHRAKVEELREHLLRGGFTT

References
Author Title Citation
Iqbal, HS Primary HIV-1 drug resistance and polymorphic patterns among injecting drug users (IDUs) in Chennai, southern India. J Int Assoc Physicians AIDS Care (Chic), 2009