<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
V2000-14 V2000-14P Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 60
2 AZT+DDI 52
3 3TC+D4T+RTV 8
4 3TC+D4T+IDV 12
5 3TC+D4T+SQV 20
6 3TC+D4T+RTV+SQV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V60I, T69N, K103R, N175K, G196E, Q197K, Q207E, R211K, F214L, D218E D113E, I159R
>V2000-14P| codons 30-226
KIKALVEICTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKRKSVTVLDVGEAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPARFQSSMTKILEPFRKQKPDIVIYQYVDDLYVGSDLEIEKHRTKIEELREHL
LKWGLTTPEQKHQKEPP

References
Author Title Citation
Venturi, G Antiretroviral resistance mutations in human immunodeficiency virus type 1 reverse transcriptase and protease from paired cerebrospinal fluid and plasma samples. J Infect Dis, 2000
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005