<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SK_0302 SK_0302 Chad 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, I15V, L19IM, K20I, M36I, R41K, H69N, K70R, L89M  
>SK_0302| codons 1-99
PQITLWQRPIVTVRVGGQMIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGNRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21VI, V35T, I50IV, V60I, D123E, I135V, S162C, Q174H, D177E, G196E, Q207E, R211K, V245Q, E248D, K249Q, D250E, K277R, T286A, E297K, A304E, D320DG, D324E, Q334H  
>SK_0302| codons 1-340
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKHNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDQESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELEENREILKEPVHGVYYGPSKELIAEIQKQGHGQWTYQ

References
Author Title Citation
Aghokeng, AF Evaluation of transmitted HIV drug resistance among recently-infected antenatal clinic attendees in four Central African countries. Antivir Ther, 2009