<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_0274 AV_0274 Chad 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, M36I, R41K, R57K, Q61QH, L63A, E65ED  
>AV_0274| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
HIAIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39K, E40D, E53D, V60I, V106VI, T107S, V111VI, K122E, D123EQ, S162CF, D177E, I178L, E194EK, Q207E, R211RK, F214L, L228LH, E233EK, V245E, D250E, A272P, K277R, T286A, V292I, E297R  
>AV_0274| codons 1-309
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKDMEKEGKISKIGPDNPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSISVLDIGDAYFSVPL
DEQFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLKIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFHWMGYKLHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIIPLTREAE
LELAENREI

References
Author Title Citation
Aghokeng, AF Evaluation of transmitted HIV drug resistance among recently-infected antenatal clinic attendees in four Central African countries. Antivir Ther, 2009