<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_0206 AV_0206 Chad 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G17E, K20I, M36I, N37K, R41K, K55KR, L89M  
>AV_0206| codons 1-99
PQITLWQRPVVTVKIGEQLIEALLDTGADDTVLEEIKLPGKWKPKMIGGIGGFIRVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, T39N, K49R, V60I, D123DGNS, I135T, K166R, K173A, Q174K, D177E, Q207AD, I244V, V245K, T286A, A288G, E291D, V292I, I293V, P294T, L295M, G335D  
>AV_0206| codons 1-341
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKSFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKGLTDIVTMTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQI

References
Author Title Citation
Aghokeng, AF Evaluation of transmitted HIV drug resistance among recently-infected antenatal clinic attendees in four Central African countries. Antivir Ther, 2009