<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
V2000-24 V2000-24P Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 120
2 DDI 40
3 AZT+DDI 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70G T215I, K219Q     G45E, I50V, D123E, K166R, D177E, I178L  
>V2000-24P| codons 30-226
KIKALVEICTEMEKEEKISKVGPENPYNTPVFAIKKKNSTGWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTRILEPFRKQNPELVIYQYMDDLYVGSDLEIGQHRTKIEELRQHL
LRWGFITPDQKHQKEPP

References
Author Title Citation
Venturi, G Antiretroviral resistance mutations in human immunodeficiency virus type 1 reverse transcriptase and protease from paired cerebrospinal fluid and plasma samples. J Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005