<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CDB0010 CDB0010 Cameroon 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, R41K, K43R, H69K, L89M  
>CDB0010| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39L, K43T, K102Q, I135V, S162A, K173A, Q174K, D177E, T200A, Q207G, V245Q, E248N, S251Q, T286A, E291D, V292I, I293V, S322T, I326V, G335D, R356K, M357K, G359S, T369A, K374KR, I375V, K390R, K395R, E399D, T403M, E413D E29EK
>CDB0010| codons 1-426
PISPIETVPVKLKPGMDGPKVKQWPLTEKKIKALTDICLEMETEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDQWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLAEAVQRVATESIVIWGKTPKFRLPIQRETWDAWWMEYWQATWIPDWEFVNTP
PLVKLW

References
Author Title Citation
Aghokeng, AF Evaluation of transmitted HIV drug resistance among recently-infected antenatal clinic attendees in four Central African countries. Antivir Ther, 2009