<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
V2000-9 V2000-9P Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 144
2 AZT+DDI 76
3 3TC+AZT+RTV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82S L33LF R57K, D60E, I62V, L63P, A71V, V77I, I93L  
>V2000-9P| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFIKVKQYE
QVPIEICGHKVIGTVLIGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       V90VI, D121DH, K122E, I135T, D177E, T200A, R211A  
>V2000-9P| codons 30-226
KIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
IQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHL
LAWGFYTPDKKHQKEPP

References
Author Title Citation
Venturi, G Antiretroviral resistance mutations in human immunodeficiency virus type 1 reverse transcriptase and protease from paired cerebrospinal fluid and plasma samples. J Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005