<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CYM041 CYM041 Cameroon 2006 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, T12TP, K14KR, E35D, M36I, R41K, L63P, H69Q  
>CYM041| codons 1-99
PQITLWQRPIVPIRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35T, T39K, K49R, V60I, I135T, S162C, R172K, D177E, I178L, V179T, T200TA, E204EK, Q207E, R211K, F214L, V245K, D250E, S251I, A272Q, K277R, T286A, I293V, E297K, K311R, I329V, Q334E, G335S, Y339W, G359S, K366KR, T386M, K390R, A400T, T403M Q182S
>CYM041| codons 1-426
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICKEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPELTI
YSYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKEIWTVNDIQKLVGKLNWASQIYQGIKVRQLCKLLRGAKALTEVVPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEVQKQGESQWTWQIYQEPFKNLKTGKYARMRSA
HTNDVRQLTEAVQKIATESIVIWGKMPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLW

References
Author Title Citation
Aghokeng, AF Evaluation of transmitted HIV drug resistance among recently-infected antenatal clinic attendees in four Central African countries. Antivir Ther, 2009