<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
V2000-7 V2000-7P Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 192
2 DDI 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215TS   A98G K102R, D123E, K166R, D177E, Q207E  
>V2000-7P| codons 30-226
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPGGLKRKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTRILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELREHL
LRWGFSTPDKKHQKEPP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, I72V, V77VI  
>V2000-7P| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Venturi, G Antiretroviral resistance mutations in human immunodeficiency virus type 1 reverse transcriptase and protease from paired cerebrospinal fluid and plasma samples. J Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005