<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
R27 R27_RT Vietnam 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11IT, V35T, T39E, S68G, T69N, K122E, D123S, S162C, K173I, Q174K, D177E, I178M, Q207A, R211S, V245E  
>R27_RT| codons 1-250
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R57RK, L63C, H69K, K70KR, L89M, I93IL  
>R27_PR| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QICIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Ayouba, A Low prevalence of HIV type 1 drug resistance mutations in untreated, recently infected patients from Burkina Faso, Cote d'Ivoire, Senegal, Thailand, and Vietnam: The ANRS 12134 study. ARHR, 2009