<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
FD0414 FD0414PI Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, R41K, H69K, L89M  
>FD0414PI| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, V60I, K122E, D123S, I135T, Q174K, D177E, I178M, I202V, Q207A, R211S, K238R, V245D  
>FD0414RT| codons 30-254
KIKALTEICKEMEEEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKKNPEMVIYQYMDDLYVGSDLEIGQHRTKVEELRAHL
LSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIDLPEKDSWTV

References
Author Title Citation
Ayouba, A Low prevalence of HIV type 1 drug resistance mutations in untreated, recently infected patients from Burkina Faso, Cote d'Ivoire, Senegal, Thailand, and Vietnam: The ANRS 12134 study. ARHR, 2009