Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| V2000-8 | V2000-8P | Italy | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 24 |
| 2 | DDI | 40 |
| 3 | AZT+DDC | 20 |
| 4 | 3TC+AZT | 32 |
| 5 | 3TC+AZT+SQV | 48 |
| 6 | 3TC+D4T+IDV | 16 |
| 7 | D4T+NVP+RTV+SQV | 8 |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, D67N, V75M, M184I, L210W, T215Y | K219R | Y181C | V108I | V35I, K43E, E44A, V118I, K122E, D123E, G196E, Q197K, E203K, H208Y, R211K, K223Q |
| >V2000-8P| codons 30-226 KIKALIEICTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWE VQLGIPHPAGLKKKKSVTILDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVL PQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYIDDLYVGSDLEIEKHRTKIKELRQYL WKWGFYTPDRKHQQEPP |
References
| Author | Title | Citation |
| Venturi, G | Antiretroviral resistance mutations in human immunodeficiency virus type 1 reverse transcriptase and protease from paired cerebrospinal fluid and plasma samples. | J Infect Dis, 2000 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |