<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
V2000-8 V2000-8P Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 24
2 DDI 40
3 AZT+DDC 20
4 3TC+AZT 32
5 3TC+AZT+SQV 48
6 3TC+D4T+IDV 16
7 D4T+NVP+RTV+SQV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184I, L210W, T215Y K219R Y181C V108I V35I, K43E, E44A, V118I, K122E, D123E, G196E, Q197K, E203K, H208Y, R211K, K223Q  
>V2000-8P| codons 30-226
KIKALIEICTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTILDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYIDDLYVGSDLEIEKHRTKIKELRQYL
WKWGFYTPDRKHQQEPP

References
Author Title Citation
Venturi, G Antiretroviral resistance mutations in human immunodeficiency virus type 1 reverse transcriptase and protease from paired cerebrospinal fluid and plasma samples. J Infect Dis, 2000
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005