<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
FD0419 FD0419RT Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E40D, K64R, K122E, D123S, K173I, Q174K, D177E, Q207A, R211S, K238R, V245E  
>FD0419RT| codons 30-254
KIKALVEICTDMEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRAHL
LSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, I62V, L63P, V77I, I93L  
>FD0419PI| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Ayouba, A Low prevalence of HIV type 1 drug resistance mutations in untreated, recently infected patients from Burkina Faso, Cote d'Ivoire, Senegal, Thailand, and Vietnam: The ANRS 12134 study. ARHR, 2009