<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
0.618 0.618-EPR Burkina Faso 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, K20I, M36I, R41K, L63T, H69K, L89M  
>0.618-EPR| codons 1-99
PQITLWQRPLVTARIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, V60I, K122E, D123N, R125K, I135V, S162A, K173T, Q174K, D177E, I178L, T200A  
>0.618-ERT| codons 32-206
KALTDICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFKKYTAFTIPSVNNETPGIRYQYNVLPQ
GWKGSPAIFQASMTKILEPFRTKNPELVIYQYMDDLYVGSDLEIGQHRAKIEELR

References
Author Title Citation
Ayouba, A Low prevalence of HIV type 1 drug resistance mutations in untreated, recently infected patients from Burkina Faso, Cote d'Ivoire, Senegal, Thailand, and Vietnam: the ANRS 12134 study. ARHR, 2009