<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4398 CA14956 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDC 25
2 3TC+D4T+IDV 72
3 3TC+D4T+RTV+SQV 76
4 APV+D4T+DDI+NVP+RTV 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, R41RK, K43KR, I62V, L63P, H69Y, A71T, I72E, V77I, I93L  
>CA14956| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGYKTEGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   K103N   S68G, K122E, I135IT, S162A, I178M, Q207E, R211K, A272P, I293V K259K*
>CA14806| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ*LVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005