<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4465 CA14941 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+AZT+SQV 12
3 3TC+NFV+SQV 35
4 3TC+DDI+NVP 8
5 3TC+AZT+RTV+SQV 8
6 ABC+D4T+Unknown 58
7 3TC+ABC+APV+D4T+DDI 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M T74P L10I, K20R, E35D, M36I, N37D, R41K, Q61N, I62V, L63HPQ, I64M, A71V, I93L  
>CA14941| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKLIGGIGGFVKVRQYD
NVQMEICGHKVIGPVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, M184V, L210W, T215Y       K20R, K43EQ, E44D, S48T, A98S, V118I, K122E, D123E, S162A, D177E, T200A, H208F, R211K, D218E, E224ED, V245VL, S251SR, A272P, K277R, R284RK, I293V, E297A K238K*, T253TS, A267AP, K287KN
>CA14807| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQDGKITKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQFLWKWGFYTPEKKHQKDPPFLWMGYELHPD*WT
VQPILLPEKDRWSVNDIQKLVGKLNWPSQIYPGIKVRQLCKLLKGTNALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005